| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
| Protein automated matches [254645] (42 species) not a true protein |
| Species Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337345] (3 PDB entries) |
| Domain d5xl8b2: 5xl8 B:333-499 [337429] Other proteins in same PDB: d5xl8a1, d5xl8b1, d5xl8c1 automated match to d1ha0a2 complexed with nag; mutant |
PDB Entry: 5xl8 (more details), 2 Å
SCOPe Domain Sequences for d5xl8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xl8b2 h.3.1.0 (B:333-499) automated matches {Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
iagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektndkyhq
iekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfervrrq
lrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfq
Timeline for d5xl8b2:
View in 3DDomains from other chains: (mouse over for more information) d5xl8a1, d5xl8a2, d5xl8c1, d5xl8c2 |