Lineage for d5xdwa2 (5xdw A:209-315)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2960042Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2960043Protein automated matches [226843] (9 species)
    not a true protein
  7. 2960086Species Staphylococcus aureus [TaxId:282458] [334408] (7 PDB entries)
  8. 2960091Domain d5xdwa2: 5xdw A:209-315 [337414]
    Other proteins in same PDB: d5xdwa1, d5xdwa3
    automated match to d4m8ia2
    complexed with ca, gdp

Details for d5xdwa2

PDB Entry: 5xdw (more details), 2 Å

PDB Description: staphylococcus aureus ftsz 12-316 g196s
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d5xdwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xdwa2 d.79.2.0 (A:209-315) automated matches {Staphylococcus aureus [TaxId: 282458]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

SCOPe Domain Coordinates for d5xdwa2:

Click to download the PDB-style file with coordinates for d5xdwa2.
(The format of our PDB-style files is described here.)

Timeline for d5xdwa2: