Lineage for d5xp1h1 (5xp1 H:0-95)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2759015Domain d5xp1h1: 5xp1 H:0-95 [337409]
    Other proteins in same PDB: d5xp1a2, d5xp1b2, d5xp1c2, d5xp1d2, d5xp1e2, d5xp1f2, d5xp1g2, d5xp1h2
    automated match to d4v1db_
    mutant

Details for d5xp1h1

PDB Entry: 5xp1 (more details), 2.88 Å

PDB Description: structure of monomeric mutant of rei immunoglobulin light chain variable domain crystallized at ph 6
PDB Compounds: (H:) Immunoglobulin kappa variable 1D-33

SCOPe Domain Sequences for d5xp1h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xp1h1 b.1.1.0 (H:0-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvp
srfsgsgsgtdytftisslqpediatyycqqyqslp

SCOPe Domain Coordinates for d5xp1h1:

Click to download the PDB-style file with coordinates for d5xp1h1.
(The format of our PDB-style files is described here.)

Timeline for d5xp1h1: