Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (2 families) |
Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein) |
Protein DNA repair protein MutS, domain II [53152] (2 species) |
Species Thermus aquaticus [TaxId:271] [53153] (4 PDB entries) |
Domain d1ewqa3: 1ewq A:121-266 [33740] Other proteins in same PDB: d1ewqa1, d1ewqa2, d1ewqa4, d1ewqb1, d1ewqb2, d1ewqb4 CASP4 protein/DNA complex; complexed with edo, so4 |
PDB Entry: 1ewq (more details), 2.2 Å
SCOPe Domain Sequences for d1ewqa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewqa3 c.55.6.1 (A:121-266) DNA repair protein MutS, domain II {Thermus aquaticus [TaxId: 271]} llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp frfydpgafmrlpeatlralevfepl
Timeline for d1ewqa3:
View in 3D Domains from other chains: (mouse over for more information) d1ewqb1, d1ewqb2, d1ewqb3, d1ewqb4 |