Lineage for d5xl2c1 (5xl2 C:5-323)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776384Species Influenza A virus (a/swine/ontario/01911-1/99 (h4n6)) [TaxId:137611] [337392] (1 PDB entry)
  8. 2776387Domain d5xl2c1: 5xl2 C:5-323 [337393]
    Other proteins in same PDB: d5xl2a2, d5xl2b2, d5xl2c2
    automated match to d1ha0a1
    complexed with nag

Details for d5xl2c1

PDB Entry: 5xl2 (more details), 2.3 Å

PDB Description: the structure of hemagglutininfrom a swine-origin h4n6 influenza virus
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d5xl2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xl2c1 b.19.1.0 (C:5-323) automated matches {Influenza A virus (a/swine/ontario/01911-1/99 (h4n6)) [TaxId: 137611]}
gnpviclghhavsngtmvktltddqievvtaqelvesqhlpelcpsplrlvdgqtcdivn
galgspgcdhlngaewdvfierptavdtcypfdvpdyqslrsilanngkfefiaeefqwn
tvkqngksgackranvndffnrlnwltksdgnayplqnltkvnngdyarlyiwgvhhpst
dteqtnlyknnpgrvtvstqtsqtsvvpnigsrpwvrglssrisfywtivepgdlivfnt
ignliaprghyklnsqkkstilntavpigscvskchtdkgsisttkpfqnisrisigdcp
kyvkqgslklatgmrnipe

SCOPe Domain Coordinates for d5xl2c1:

Click to download the PDB-style file with coordinates for d5xl2c1.
(The format of our PDB-style files is described here.)

Timeline for d5xl2c1: