![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [337387] (1 PDB entry) |
![]() | Domain d5xvqb_: 5xvq B: [337388] automated match to d2i62b_ complexed with 8gc, gol, sah |
PDB Entry: 5xvq (more details), 2.29 Å
SCOPe Domain Sequences for d5xvqb_:
Sequence, based on SEQRES records: (download)
>d5xvqb_ c.66.1.0 (B:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} ftskdtylrhfnprdylekyykfgsrhsaesqilkhllenlfkifcldgvkgdllidigs gptiyqllsacesfkeiivtdysdqnlqelekwlkkepeafdwspvvtyvcdlegnrvkg pekeeklrqavkqvlkcdvtqsqplgavplpladcllstlcldaacpdlptyrralrnlg sllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsyss tmanneglfslvgrkls
>d5xvqb_ c.66.1.0 (B:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} ftskdtylrhfnprdylekyyksaesqilkhllenlfkifcldgvkgdllidigsgptiy qllsacesfkeiivtdysdqnlqelekwlkkepeafdwspvvtyvcdlegnrvkgpekee klrqavkqvlkcdvtqsqplgavplpladcllstlcldaacpdlptyrralrnlgsllkp ggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsysstmann eglfslvgrkls
Timeline for d5xvqb_: