SCOPe 2.07: Domain d5xl9a2: 5xl9 A:333-499

Lineage for d5xl9a2 (5xl9 A:333-499)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337345] (3 PDB entries)

8. Domain d5xl9a2: 5xl9 A:333-499 [337383]
   Other proteins in same PDB: d5xl9a1, d5xl9b1, d5xl9c1
   automated match to d1ha0a2
   complexed with nag, sia; mutant

Details for d5xl9a2

PDB Entry: 5xl9, 2.39 Å

PDB Description: the structure of hemagglutinin g228s mutant from an avian-origin h4n6 influenza virus in complex with avian receptor analog lsta

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5xl9a2:

Sequence; same for both SEQRES and ATOM records:

>d5xl9a2 h.3.1.0 (A:333-499) automated matches {Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
iagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektndkyhq
iekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfervrrq
lrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfq

Timeline for d5xl9a2:

• d5xl9a2 first appeared in SCOPe 2.06
  
• d5xl9a2 appears in the current release, SCOPe 2.08