Lineage for d1hnxk_ (1hnx K:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 72254Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 72255Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 72260Protein Ribosomal protein S11 [53141] (1 species)
  7. 72261Species Thermus thermophilus [TaxId:274] [53142] (10 PDB entries)
  8. 72268Domain d1hnxk_: 1hnx K: [33737]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_

Details for d1hnxk_

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxk_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOP Domain Coordinates for d1hnxk_:

Click to download the PDB-style file with coordinates for d1hnxk_.
(The format of our PDB-style files is described here.)

Timeline for d1hnxk_: