![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337300] (12 PDB entries) |
![]() | Domain d5xl8c1: 5xl8 C:5-323 [337344] Other proteins in same PDB: d5xl8a2, d5xl8b2, d5xl8c2 automated match to d1ha0a1 complexed with nag; mutant |
PDB Entry: 5xl8 (more details), 2 Å
SCOPe Domain Sequences for d5xl8c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xl8c1 b.19.1.0 (C:5-323) automated matches {Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]} gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqssrvsfywtivepgdlivfnt ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp ryvkqgslklatgmrnipe
Timeline for d5xl8c1:
![]() Domains from other chains: (mouse over for more information) d5xl8a1, d5xl8a2, d5xl8b1, d5xl8b2 |