Lineage for d1fjgk_ (1fjg K:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181999Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 182512Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 182513Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 182525Protein Ribosomal protein S11 [53141] (1 species)
  7. 182526Species Thermus thermophilus [TaxId:274] [53142] (10 PDB entries)
  8. 182527Domain d1fjgk_: 1fjg K: [33733]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_

Details for d1fjgk_

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgk_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOP Domain Coordinates for d1fjgk_:

Click to download the PDB-style file with coordinates for d1fjgk_.
(The format of our PDB-style files is described here.)

Timeline for d1fjgk_: