![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337300] (12 PDB entries) |
![]() | Domain d5xl5b_: 5xl5 B: [337317] Other proteins in same PDB: d5xl5c_, d5xl5d_ automated match to d4uoaa_ complexed with nag; mutant |
PDB Entry: 5xl5 (more details), 2.2 Å
SCOPe Domain Sequences for d5xl5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xl5b_ b.19.1.0 (B:) automated matches {Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]} gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrglsgrvsfywtivepgdlivfnt ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp ryvkqgslklatgmrnipe
Timeline for d5xl5b_: