Lineage for d5xlcb_ (5xlc B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776399Species Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337300] (12 PDB entries)
  8. 2776418Domain d5xlcb_: 5xlc B: [337313]
    Other proteins in same PDB: d5xlcc_, d5xlcd_
    automated match to d4uoaa_
    complexed with nag, sia; mutant

Details for d5xlcb_

PDB Entry: 5xlc (more details), 2.4 Å

PDB Description: the structure of hemagglutinin q226l-g228s mutant from an avian-origin h4n6 influenza virus in complex with avian receptor analog lsta
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5xlcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xlcb_ b.19.1.0 (B:) automated matches {Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin
galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn
tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst
dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrglssrvsfywtivepgdlivfnt
ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp
ryvkqgslklatgmrnipe

SCOPe Domain Coordinates for d5xlcb_:

Click to download the PDB-style file with coordinates for d5xlcb_.
(The format of our PDB-style files is described here.)

Timeline for d5xlcb_: