Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (2 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein L18 (L18p) [53139] (3 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (19 PDB entries) |
Domain d1ffkk_: 1ffk K: [33731] Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_ complexed with cd, k, mo3; mutant |
PDB Entry: 1ffk (more details), 2.4 Å
SCOP Domain Sequences for d1ffkk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffkk_ c.55.4.1 (K:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui} atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll dgdiel
Timeline for d1ffkk_: