Lineage for d1ffkk_ (1ffk K:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245987Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 246546Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 246547Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 246548Protein Ribosomal protein L18 (L18p) [53139] (2 species)
  7. 246549Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (8 PDB entries)
  8. 246553Domain d1ffkk_: 1ffk K: [33731]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_
    complexed with cd, k, mo3; mutant

Details for d1ffkk_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkk_ c.55.4.1 (K:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1ffkk_:

Click to download the PDB-style file with coordinates for d1ffkk_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkk_: