Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337300] (12 PDB entries) |
Domain d5xl1a_: 5xl1 A: [337301] Other proteins in same PDB: d5xl1c_, d5xl1d_ automated match to d4uoaa_ complexed with nag |
PDB Entry: 5xl1 (more details), 2.3 Å
SCOPe Domain Sequences for d5xl1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xl1a_ b.19.1.0 (A:) automated matches {Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]} gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqsgrvsfywtivepgdlivfnt ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp ryvkqgslklatgmrnipe
Timeline for d5xl1a_: