Lineage for d1hjrc_ (1hjr C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25425Family c.55.3.6: RuvC resolvase [53134] (1 protein)
  6. 25426Protein RuvC resolvase [53135] (1 species)
  7. 25427Species Escherichia coli [TaxId:562] [53136] (1 PDB entry)
  8. 25430Domain d1hjrc_: 1hjr C: [33729]

Details for d1hjrc_

PDB Entry: 1hjr (more details), 2.5 Å

PDB Description: atomic structure of the ruvc resolvase: a holliday junction-specific endonuclease from e. coli

SCOP Domain Sequences for d1hjrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjrc_ c.55.3.6 (C:) RuvC resolvase {Escherichia coli}
aiilgidpgsrvtgygvirqvgrqlsylgsgcirtkvddlpsrlkliyagvteiitqfqp
dyfaieqvfmaknadsalklgqargvaivaavnqelpvfeyaarqvkqtvvgigsaeksq
vqhmvrtllklpanpqadaadalaiaithchvsqnamq

SCOP Domain Coordinates for d1hjrc_:

Click to download the PDB-style file with coordinates for d1hjrc_.
(The format of our PDB-style files is described here.)

Timeline for d1hjrc_: