SCOPe 2.08: Domain d5wi5c_: 5wi5 C:

Lineage for d5wi5c_ (5wi5 C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.2: EPT/RTPC-like [55205] (3 families)

5. Family d.68.2.0: automated matches [191521] (1 protein)
   not a true family

6. Protein automated matches [190878] (15 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [337266] (2 PDB entries)

8. Domain d5wi5c_: 5wi5 C: [337267]
   automated match to d3vcya_
   complexed with 0v5, epu, mg

Details for d5wi5c_

PDB Entry: 5wi5, 2 Å

PDB Description: 2.0 angstrom resolution crystal structure of udp-n-acetylglucosamine 1-carboxyvinyltransferase from streptococcus pneumoniae in complex with uridine-diphosphate-2(n-acetylglucosaminyl) butyric acid, (2r)- 2-(phosphonooxy)propanoic acid and magnesium.

PDB Compounds: (C:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1

SCOPe Domain Sequences for d5wi5c_:

Sequence; same for both SEQRES and ATOM records:

>d5wi5c_ d.68.2.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
mdkivvqggdnrlvgsvtiegaknavlpllaatilasegktvlqnvpilsdvfimnqvvg
glnakvdfdeeahlvkvdatgditeeapykyvskmrasivvlgpilarvghakvsmpggc
tigsrpidlhlkgleamgvkisqtagyieakaerlhgahiymdfpsvgatqnlmmaatla
dgvtvienaarepeivdlaillnemgakvkgagtetititgveklhgtthnvvqdrieag
tfmvaaamtggdvlirdavwehnrpliakllemgvevieedegirvrsqlenlkavhvkt
lphpgfptdmqaqftalmtvakgestmvetvfenrfqhleemrrmglhseiirdtarivg
gqplqgaevlstdlrasaaliltglvaqgetvvgklvhldrgyygfheklaqlgakiqri
e

Timeline for d5wi5c_:

• d5wi5c_ first appeared in SCOPe 2.06
  
• d5wi5c_ appears in SCOPe 2.07