Lineage for d1fxxa1 (1fxx A:8-475)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124334Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 protein domains)
    contains Pfam PF00929
  6. 2124644Protein Exonuclease I [53132] (2 species)
    also includes an alpha+beta domain with SH3-like like motif and non-globular C-terminal all-alpha region
  7. 2124649Species Escherichia coli [TaxId:562] [53133] (1 PDB entry)
  8. 2124650Domain d1fxxa1: 1fxx A:8-475 [33726]
    Other proteins in same PDB: d1fxxa2
    complexed with gol, mg, po4

Details for d1fxxa1

PDB Entry: 1fxx (more details), 2.4 Å

PDB Description: the structure of exonuclease i suggests how processivity is achieved
PDB Compounds: (A:) exonuclease I

SCOPe Domain Sequences for d1fxxa1:

Sequence, based on SEQRES records: (download)

>d1fxxa1 c.55.3.5 (A:8-475) Exonuclease I {Escherichia coli [TaxId: 562]}
qstflfhdyetfgthpaldrpaqfaairtdsefnvigepevfyckpaddylpqpgavlit
gitpqearakgeneaafaarihslftvpktcilgynnvrfddevtrnifyrnfydpyaws
wqhdnsrwdlldvmracyalrpeginwpenddglpsfrlehltkangiehsnahdamadv
yatiamaklvktrqprlfdylfthrnkhklmalidvpqmkplvhvsgmfgawrgntswva
plawhpenrnavimvdlagdisplleldsdtlrerlytaktdlgdnaavpvklvhinkcp
vlaqantlrpedadrlginrqhcldnlkilrenpqvrekvvaifaeaepftpsdnvdaql
yngffsdadraamkivleteprnlpalditfvdkriekllfnyrarnfpgtldyaeqqrw
lehrrqvftpeflqgyadelqmlvqqyaddkekvallkalwqyadeiv

Sequence, based on observed residues (ATOM records): (download)

>d1fxxa1 c.55.3.5 (A:8-475) Exonuclease I {Escherichia coli [TaxId: 562]}
qstflfhdyetfgthpaldrpaqfaairtdsefnvigepevfyckpaddylpqpgavlit
gitpqearakgeneaafaarihslftvpktcilgynnvrfddevtrnifyrnfydpyaws
wqhdnsrwdlldvmracyalrpeginwpeglpsfrlehltkangiehsnahdamadvyat
iamaklvktrqprlfdylfthrnkhklmalidvpqmkplvhvsgmfgawrgntswvapla
whpenrnavimvdlagdisplleldsdtlrerlytaktdlavpvklvhinkcpvlaqant
lrpedadrlginrqhcldnlkilrenpqvrekvvaifaeapsdnvdaqlyngffsdadra
amkivleteprnlpalditfvdkriekllfnyrarnfpgtldyaeqqrwlehrrqvftpe
flqgyadelqmlvqqyaddkekvallkalwqyadeiv

SCOPe Domain Coordinates for d1fxxa1:

Click to download the PDB-style file with coordinates for d1fxxa1.
(The format of our PDB-style files is described here.)

Timeline for d1fxxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fxxa2