SCOP 1.65: Domain d1gcxa1: 1gcx A:1-347

Lineage for d1gcxa1 (1gcx A:1-347)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (6 proteins)

6. Protein Exonuclease domain of family B (archaeal and phage) DNA polymerases [53125] (6 species)
   elaborated with additional structures and the N-terminal subdomain
   the N-terminal subdomain of archaeal polymerases contains ferredoxin-like fold

7. Species Archaeon Pyrococcus kodakaraensis [TaxId:311400] [53131] (1 PDB entry)

8. Domain d1gcxa1: 1gcx A:1-347 [33725]
   Other proteins in same PDB: d1gcxa2

Details for d1gcxa1

PDB Entry: 1gcx, 3 Å

PDB Description: crystal structure of family b dna polymerase from hyperthermophilic archaeon pyrococcus kodakaraensis kod1

SCOP Domain Sequences for d1gcxa1:

Sequence; same for both SEQRES and ATOM records:

>d1gcxa1 c.55.3.5 (A:1-347) Exonuclease domain of family B (archaeal and phage) DNA polymerases {Archaeon Pyrococcus kodakaraensis}
mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
lidkglvpmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknvdlpy
vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrs

Timeline for d1gcxa1:

• d1gcxa1 first appeared (with stable ids) in SCOP 1.55
  
• d1gcxa1 appears in SCOP 1.63
  
• d1gcxa1 last appears in SCOP 1.67