SCOPe 2.06: Domain d5oe2d_: 5oe2 D:

Lineage for d5oe2d_ (5oe2 D:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (40 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (23 PDB entries)

8. Domain d5oe2d_: 5oe2 D: [337249]
   automated match to d1nrfa_
   complexed with cl, na

Details for d5oe2d_

PDB Entry: 5oe2, 2.2 Å

PDB Description: crystal structure of the beta-lactamase oxa-245

PDB Compounds: (D:) Beta-lactamase

SCOPe Domain Sequences for d5oe2d_:

Sequence; same for both SEQRES and ATOM records:

>d5oe2d_ e.3.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdl
gvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqyfarqigearmskmlhafd
ygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdy
iiraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqeki
ip

Timeline for d5oe2d_:

• d5oe2d_ is new in SCOPe 2.06-stable
  
• d5oe2d_ appears in SCOPe 2.07
  
• d5oe2d_ appears in the current release, SCOPe 2.08