SCOPe 2.08: Domain d5ufeb_: 5ufe B:

Lineage for d5ufeb_ (5ufe B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: Histone-like proteins from archaea [54161] (2 proteins)

6. Protein automated matches [190114] (2 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [337247] (4 PDB entries)

8. Domain d5ufeb_: 5ufe B: [337248]
   Other proteins in same PDB: d5ufea_
   automated match to d1bbxc_
   complexed with ca, cd, cl, co, gnp, mg

Details for d5ufeb_

PDB Entry: 5ufe, 2.3 Å

PDB Description: wild-type k-ras(gnp)/r11.1.6 complex

PDB Compounds: (B:) r11.1.6

SCOPe Domain Sequences for d5ufeb_:

Sequence, based on SEQRES records:

>d5ufeb_ b.34.13.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
atvkfthqgeekqvdiskikwvirwgqyiwfkydedggakgwgyvsekdapkellqml

Sequence, based on observed residues (ATOM records):

>d5ufeb_ b.34.13.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
atvkftgeekqvdiskikwvirwgqyiwfkydedakgwgyvsekdapkellqml

Timeline for d5ufeb_:

• d5ufeb_ first appeared in SCOPe 2.06
  
• d5ufeb_ appears in SCOPe 2.07