Lineage for d5oclh_ (5ocl H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745477Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)
  8. 2745561Domain d5oclh_: 5ocl H: [337231]
    automated match to d2p49b_

Details for d5oclh_

PDB Entry: 5ocl (more details), 2.2 Å

PDB Description: nanobody-anti-vglut nanobody complex
PDB Compounds: (H:) anti-llama nanobody

SCOPe Domain Sequences for d5oclh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oclh_ b.1.1.1 (H:) automated matches {Vicugna pacos [TaxId: 30538]}
qgqlvesggglvqaggslrlscaasgiifrelgidwyrqapgkqrelvasiasagmtnya
dsvkgrftisrdnakntvylqmnslkpedtavyychtlprfshlwgqgtrvtvss

SCOPe Domain Coordinates for d5oclh_:

Click to download the PDB-style file with coordinates for d5oclh_.
(The format of our PDB-style files is described here.)

Timeline for d5oclh_: