Lineage for d5mo9x_ (5mo9 X:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758474Domain d5mo9x_: 5mo9 X: [337230]
    Other proteins in same PDB: d5mo9h2, d5mo9l1
    automated match to d1wway_

Details for d5mo9x_

PDB Entry: 5mo9 (more details), 2.59 Å

PDB Description: structure of human trkb receptor ligand binding domain in complex with the fab frgment of antibody ab20
PDB Compounds: (X:) bdnf/nt-3 growth factors receptor

SCOPe Domain Sequences for d5mo9x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mo9x_ b.1.1.0 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vhfaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
hgclqldnpthmnngdytliakneygkdekqisahfmgwpgi

SCOPe Domain Coordinates for d5mo9x_:

Click to download the PDB-style file with coordinates for d5mo9x_.
(The format of our PDB-style files is described here.)

Timeline for d5mo9x_: