SCOP 1.71: Domain d1d5aa1: 1d5a A:1-347

Lineage for d1d5aa1 (1d5a A:1-347)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (10 proteins)
   contains Pfam 00929

6. Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
   elaborated with additional structures and the N-terminal subdomain

7. Species Archaeon Desulfurococcus tok [TaxId:108142] [53130] (2 PDB entries)
   additional N-terminal subdomain contains rudimental OB-fold but complete ferredoxin-like fold

8. Domain d1d5aa1: 1d5a A:1-347 [33723]
   Other proteins in same PDB: d1d5aa2
   complexed with mg, so4

Details for d1d5aa1

PDB Entry: 1d5a, 2.4 Å

PDB Description: crystal structure of an archaebacterial dna polymerase d.tok. deposition of second native structure at 2.4 angstrom

SCOP Domain Sequences for d1d5aa1:

Sequence; same for both SEQRES and ATOM records:

>d1d5aa1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Archaeon Desulfurococcus tok}
mildadyitedgkpvirvfkkekgefkidydrdfepyiyallkddsaiedikkitaerhg
ttvrvtraervkkkflgrpvevwklyfthpqdvpairdkirehpavvdiyeydipfakry
lidrglipmegdeelrmlafdietlahagaaagagpilmisyadeegarvitwknidlpy
vesvstekemikrflkviqekdpdvlityngdnfdfaylkkrsemlgvkfilgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytletvyepvfgqpaekvyaeeiaeawa
sgeglervarysmedakatyelgkeffpmeaqlsrlvgqslwdvsrs

Timeline for d1d5aa1:

• d1d5aa1 first appeared (with stable ids) in SCOP 1.55
  
• d1d5aa1 appears in SCOP 1.69
  
• d1d5aa1 appears in SCOP 1.73
  
• d1d5aa1 appears in the current release, SCOPe 2.08