Lineage for d5mx2a_ (5mx2 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027502Protein automated matches [190224] (17 species)
    not a true protein
  7. 3027611Species Thermosynechococcus elongatus [TaxId:197221] [260543] (10 PDB entries)
  8. 3027617Domain d5mx2a_: 5mx2 A: [337229]
    Other proteins in same PDB: d5mx2b_, d5mx2c_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2x_, d5mx2z_
    automated match to d2axta1
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd

Details for d5mx2a_

PDB Entry: 5mx2 (more details), 2.2 Å

PDB Description: photosystem ii depleted of the mn4cao5 cluster at 2.55 a resolution
PDB Compounds: (A:) Photosystem II protein D1 1

SCOPe Domain Sequences for d5mx2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mx2a_ f.26.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
nlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgsl
lygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrqw
elsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaehn
ilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetynivaa
hgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidakg
nvintwadiinranlgmevmhernahnfpldla

SCOPe Domain Coordinates for d5mx2a_:

Click to download the PDB-style file with coordinates for d5mx2a_.
(The format of our PDB-style files is described here.)

Timeline for d5mx2a_: