SCOPe 2.08: Domain d5mx2j_: 5mx2 J:

Lineage for d5mx2j_ (5mx2 J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families)
   automatically mapped to Pfam PF01788

5. Family f.23.32.1: PsbJ-like [161022] (2 proteins)
   Pfam PF01788

6. Protein automated matches [191002] (3 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (25 PDB entries)

8. Domain d5mx2j_: 5mx2 J: [337226]
   Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2c_, d5mx2d_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2k_, d5mx2l_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2x_, d5mx2z_
   automated match to d5b5ej_
   complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd

Details for d5mx2j_

PDB Entry: 5mx2, 2.2 Å

PDB Description: photosystem ii depleted of the mn4cao5 cluster at 2.55 a resolution

PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5mx2j_:

Sequence; same for both SEQRES and ATOM records:

>d5mx2j_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
iplwivatvagmgvivivglffygayaglgssl

Timeline for d5mx2j_:

• d5mx2j_ first appeared in SCOPe 2.06
  
• d5mx2j_ appears in SCOPe 2.07