Lineage for d1qhta1 (1qht A:1-347)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2494311Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2494323Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 2494474Species Thermococcus sp., 9on-7 [TaxId:35749] [53129] (1 PDB entry)
    additional N-terminal subdomain contains rudimental OB-fold but complete ferredoxin-like fold
  8. 2494475Domain d1qhta1: 1qht A:1-347 [33722]
    Other proteins in same PDB: d1qhta2

Details for d1qhta1

PDB Entry: 1qht (more details), 2.1 Å

PDB Description: dna polymerase from thermococcus sp. 9on-7 archaeon
PDB Compounds: (A:) protein (DNA polymerase)

SCOPe Domain Sequences for d1qhta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhta1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Thermococcus sp., 9on-7 [TaxId: 35749]}
mildtdyitengkpvirvfkkengefkieydrtfepyfyallkddsaiedvkkvtakrhg
tvvkvkraekvqkkflgrpievwklyfnhpqdvpairdrirahpavvdiyeydipfakry
lidkglipmegdeeltmlafaiatlyhegeefgtgpilmisyadgsearvitwkkidlpy
vdvvstekemikrflrvvrekdpdvlityngdnfdfaylkkrceelgikftlgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgkpkekvyaeeiaqawe
sgeglervarysmedakvtyelgreffpmeaqlsrligqslwdvsrs

SCOPe Domain Coordinates for d1qhta1:

Click to download the PDB-style file with coordinates for d1qhta1.
(The format of our PDB-style files is described here.)

Timeline for d1qhta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qhta2