SCOP 1.75: Domain d1qhta1: 1qht A:1-347

Lineage for d1qhta1 (1qht A:1-347)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (14 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
   elaborated with additional structures and the N-terminal subdomain

7. Species Archaeon Thermococcus sp., 9on-7 [TaxId:35749] [53129] (1 PDB entry)
   additional N-terminal subdomain contains rudimental OB-fold but complete ferredoxin-like fold

8. Domain d1qhta1: 1qht A:1-347 [33722]
   Other proteins in same PDB: d1qhta2
   mutant

Details for d1qhta1

PDB Entry: 1qht, 2.1 Å

PDB Description: dna polymerase from thermococcus sp. 9on-7 archaeon

PDB Compounds: (A:) protein (DNA polymerase)

SCOP Domain Sequences for d1qhta1:

Sequence; same for both SEQRES and ATOM records:

>d1qhta1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Archaeon Thermococcus sp., 9on-7 [TaxId: 35749]}
mildtdyitengkpvirvfkkengefkieydrtfepyfyallkddsaiedvkkvtakrhg
tvvkvkraekvqkkflgrpievwklyfnhpqdvpairdrirahpavvdiyeydipfakry
lidkglipmegdeeltmlafaiatlyhegeefgtgpilmisyadgsearvitwkkidlpy
vdvvstekemikrflrvvrekdpdvlityngdnfdfaylkkrceelgikftlgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgkpkekvyaeeiaqawe
sgeglervarysmedakvtyelgreffpmeaqlsrligqslwdvsrs

Timeline for d1qhta1:

• d1qhta1 first appeared (with stable ids) in SCOP 1.55
  
• d1qhta1 appears in SCOP 1.73
  
• d1qhta1 appears in SCOPe 2.01
  
• d1qhta1 appears in the current release, SCOPe 2.08