SCOP 1.67: Domain d1tgoa1: 1tgo A:1-347

Lineage for d1tgoa1 (1tgo A:1-347)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (9 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)

6. Protein Exonuclease domain of family B DNA polymerases [53125] (7 species)
   elaborated with additional structures and the N-terminal subdomain

7. Species Archaeon Thermococcus gorgonarius [TaxId:71997] [53128] (1 PDB entry)
   additional N-terminal subdomain contains rudimental OB-fold but complete ferredoxin-like fold

8. Domain d1tgoa1: 1tgo A:1-347 [33721]
   Other proteins in same PDB: d1tgoa2

Details for d1tgoa1

PDB Entry: 1tgo, 2.5 Å

PDB Description: thermostable b type dna polymerase from thermococcus gorgonarius

SCOP Domain Sequences for d1tgoa1:

Sequence; same for both SEQRES and ATOM records:

>d1tgoa1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Archaeon Thermococcus gorgonarius}
mildtdyitedgkpvirifkkengefkidydrnfepyiyallkddsaiedvkkitaerhg
ttvrvvraekvkkkflgrpievwklyfthpqdvpairdkikehpavvdiyeydipfakry
lidkglipmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknidlpy
vdvvstekemikrflkvvkekdpdvlityngdnfdfaylkkrseklgvkfilgregsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeaifgqpkekvyaeeiaqawe
tgeglervarysmedakvtyelgkeffpmeaqlsrlvgqslwdvsrs

Timeline for d1tgoa1:

• d1tgoa1 first appeared (with stable ids) in SCOP 1.55
  
• d1tgoa1 appears in SCOP 1.65
  
• d1tgoa1 appears in SCOP 1.69
  
• d1tgoa1 appears in the current release, SCOPe 2.08