SCOPe 2.06: Domain d5n26a_: 5n26 A:

Lineage for d5n26a_ (5n26 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (39 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255624] (7 PDB entries)

8. Domain d5n26a_: 5n26 A: [337204]
   automated match to d3a9qe_
   complexed with 73m, cl, cpt, mg

Details for d5n26a_

PDB Entry: 5n26, 2.05 Å

PDB Description: x-ray structure of human heavy chain ferritin in complex with cisplatin

PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d5n26a_:

Sequence; same for both SEQRES and ATOM records:

>d5n26a_ a.25.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
astsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqshee
rehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklat
dkndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

Timeline for d5n26a_:

• d5n26a_ is new in SCOPe 2.06-stable
  
• d5n26a_ appears in SCOPe 2.07
  
• d5n26a_ appears in the current release, SCOPe 2.08