Lineage for d5navb_ (5nav B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2419199Species Lactobacillus plantarum [TaxId:1590] [189663] (4 PDB entries)
  8. 2419207Domain d5navb_: 5nav B: [337202]
    automated match to d2xhya_
    mutant

Details for d5navb_

PDB Entry: 5nav (more details), 2.3 Å

PDB Description: crystal structure of the double mutant (cys211ser/cys292ser) 6- phospho-b-d-glucosidase from lactobacillus plantarum
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d5navb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5navb_ c.1.8.0 (B:) automated matches {Lactobacillus plantarum [TaxId: 1590]}
mvefpegfvwgaatsgpqtegnfhkqhqnvfdywfatepeqfdagvgpdtasnfyndydh
dlalmaqagvqglrtsiqwtrliddfetaslnadgvafynhvidsmlahhitpyinlhhf
dlpvalydkyhgweskhvvelfvkfaeqcfklfgdrvdhwytfnepkvvvdgqylygwhy
pqvingpkavqvaynmnlasaktvarfhelsvrpeqqigiilnltpayaasddpadlaaa
efaelwsnnlfldpavlghfpeklverltmdgvlwdatptelaiiaanpvdslgvnyyhp
frvqrpdispkslqpwmpdiyfkeydmpgrmmnvdrgweiypqamtdiarniqknygnip
wmisengmgvageerfldkqgvvqddyridfmkehltalakgiaagsncqgyfvwsgidc
wswnhayhnryglirndihtqtktlkksakwfaelgerngf

SCOPe Domain Coordinates for d5navb_:

Click to download the PDB-style file with coordinates for d5navb_.
(The format of our PDB-style files is described here.)

Timeline for d5navb_: