Lineage for d1wafb1 (1waf B:1-375)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 837032Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
    contains Pfam PF00929
  6. 837033Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 837046Species Bacteriophage RB69 [TaxId:12353] [53127] (15 PDB entries)
    additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold
  8. 837076Domain d1wafb1: 1waf B:1-375 [33720]
    Other proteins in same PDB: d1wafa2, d1wafb2
    complexed with gmp

Details for d1wafb1

PDB Entry: 1waf (more details), 3.2 Å

PDB Description: dna polymerase from bacteriophage rb69
PDB Compounds: (B:) DNA polymerase

SCOP Domain Sequences for d1wafb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wafb1 c.55.3.5 (B:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfdipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniidvyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

SCOP Domain Coordinates for d1wafb1:

Click to download the PDB-style file with coordinates for d1wafb1.
(The format of our PDB-style files is described here.)

Timeline for d1wafb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wafb2