Lineage for d5lhva_ (5lhv A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2140830Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2141244Protein Uridine phosphorylase [53176] (6 species)
  7. 2141486Species Vibrio cholerae [TaxId:243277] [224899] (15 PDB entries)
  8. 2141535Domain d5lhva_: 5lhv A: [337190]
    automated match to d4k6oc_
    complexed with cl, gol, mg, na, so4, ura, uri

Details for d5lhva_

PDB Entry: 5lhv (more details), 1.29 Å

PDB Description: x-ray structure of uridine phosphorylase from vibrio cholerae in complex with uridine and sulfate ion at 1.29 a resolution
PDB Compounds: (A:) Uridine phosphorylase

SCOPe Domain Sequences for d5lhva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhva_ c.56.2.1 (A:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]}
ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
vvveaarkmlk

SCOPe Domain Coordinates for d5lhva_:

Click to download the PDB-style file with coordinates for d5lhva_.
(The format of our PDB-style files is described here.)

Timeline for d5lhva_: