Lineage for d5lk6a_ (5lk6 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2903076Species Sulfolobus islandicus [TaxId:930945] [337177] (1 PDB entry)
  8. 2903077Domain d5lk6a_: 5lk6 A: [337183]
    automated match to d3wj1a_
    complexed with so4

Details for d5lk6a_

PDB Entry: 5lk6 (more details), 2.6 Å

PDB Description: crystal structure of a lipase carboxylesterase from sulfolobus islandicus
PDB Compounds: (A:) alpha/beta hydrolase fold-3 domain protein

SCOPe Domain Sequences for d5lk6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lk6a_ c.69.1.0 (A:) automated matches {Sulfolobus islandicus [TaxId: 930945]}
pldprikellesgfivpigkasvdevrkifrqlasaapkvevgkvedikipgseaninar
vylpkangpygvliylhgggfvigdvesydplcraitnacncvvvsvdyrlapeykfpsa
vidsfdatnwvynnldkfdgkmgvaiagdsaggnlaavvallskgklnlkyqiliypavg
fdsvsrsmieysdgffltrehiewfgsqylrspadlldfrfspilaqdlsglppaliita
eydplrdqgeayanrllqagvpvtsvrfnnvihgflsffplieqgrdaisligsvlrrtf
yd

SCOPe Domain Coordinates for d5lk6a_:

Click to download the PDB-style file with coordinates for d5lk6a_.
(The format of our PDB-style files is described here.)

Timeline for d5lk6a_: