Lineage for d5ljfa_ (5ljf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833279Species Uncultured bacterium [TaxId:77133] [188624] (13 PDB entries)
  8. 2833286Domain d5ljfa_: 5ljf A: [337182]
    automated match to d4ee9a_

Details for d5ljfa_

PDB Entry: 5ljf (more details), 1.73 Å

PDB Description: crystal structure of the endo-1,4-glucanase rbcel1 e135a with cellotriose
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d5ljfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ljfa_ c.1.8.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
svdliginvagaeftggklpgkhgthyffppegyfeywseqgihtvrfplkwerlqpsln
aelddvyaslvddmldqakendikvildvhnyaryrkkvigtedvpvsayqdlmeriakr
wqghdalfaydimnapygsadklwpaaaqagidgvrkydkkrplliegaswssaarwpry
adellklkdpadnmvfsahvyidedasgsykkgpgkdfepmigvkrvepfvnwlkehgkk
ghigefgipndderwldamdkllaylnencipinywaagpswgnyklsiepkdgekrpqv
allkkyaakdncsdfgpakae

SCOPe Domain Coordinates for d5ljfa_:

Click to download the PDB-style file with coordinates for d5ljfa_.
(The format of our PDB-style files is described here.)

Timeline for d5ljfa_: