Lineage for d1waja1 (1waj A:1-375)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995888Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 996218Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 996219Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 996220Species Bacteriophage RB69 [TaxId:12353] [53127] (15 PDB entries)
    additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold
  8. 996236Domain d1waja1: 1waj A:1-375 [33718]
    Other proteins in same PDB: d1waja2
    complexed with 5gp

Details for d1waja1

PDB Entry: 1waj (more details), 2.8 Å

PDB Description: dna polymerase from bacteriophage rb69
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1waja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1waja1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfdipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniidvyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

SCOPe Domain Coordinates for d1waja1:

Click to download the PDB-style file with coordinates for d1waja1.
(The format of our PDB-style files is described here.)

Timeline for d1waja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1waja2