Lineage for d1waj_1 (1waj 1-375)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) 
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) 
Protein Exonuclease domain of family B (archaeal and phage) DNA polymerases [53125] (6 species) 
Species Bacteriophage RB69 [TaxId:12353] [53127] (3 PDB entries) 
Domain d1waj_1: 1waj 1-375 [33718]
Other proteins in same PDB: d1waj_2
Details for d1waj_1
PDB Entry: 1waj (more details), 2.8 Å
PDB Description: dna polymerase from bacteriophage rb69
SCOP Domain Sequences for d1waj_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1waj_1 c.55.3.5 (1-375) Exonuclease domain of family B (archaeal and phage) DNA polymerases {Bacteriophage RB69}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfdipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniidvyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke
SCOP Domain Coordinates for d1waj_1:
Click to download the PDB-style file with coordinates for d1waj_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1waj_1:
- d1waj_1 appears in SCOP 1.57
- d1waj_1 appears in the current release, SCOPe 2.08, called d1waja1
View in 3D
