Lineage for d5huca_ (5huc A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098283Family c.1.10.8: Class-II DAHP synthetase [141840] (2 protein domains)
    Pfam PF01474
  6. 2098308Protein automated matches [191084] (3 species)
    not a true protein
  7. 2098309Species Corynebacterium glutamicum [TaxId:1718] [337160] (3 PDB entries)
  8. 2098314Domain d5huca_: 5huc A: [337161]
    automated match to d3kgfb_
    complexed with mn, mpd, pep, po4, trp

Details for d5huca_

PDB Entry: 5huc (more details), 2.45 Å

PDB Description: dahp synthase from corynebacterium glutamicum
PDB Compounds: (A:) 3-Deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase

SCOPe Domain Sequences for d5huca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5huca_ c.1.10.8 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dlpplpegmqqqfedtisrdakqqptwdraqaenvrkilesvppivvapevlelkqklad
vangkafllqggdcaetfesntephiranvktllqmavvltygastpvikmariagqyak
prssdldgnglpnyrgdivngveatpearrhdparmirayanasaamnlvraltssgtad
lyrlsewnrefvanspagaryealareidsglrfmeacgvsdeslraadiycsheallvd
yersmlrlatdeegneelydlsahqlwigertrgmddfhvnfasmisnpigikigpgitp
eeavayadkldpnfepgrltivarmghdkvrsvlpgviqaveasghkviwqsdpmhgntf
tasngyktrhfdkvidevqgffevhralgthpggihieftgedvteclggaeditdvdlp
gryesacdprlntqqslelaflvaemlrn

SCOPe Domain Coordinates for d5huca_:

Click to download the PDB-style file with coordinates for d5huca_.
(The format of our PDB-style files is described here.)

Timeline for d5huca_: