![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.8: Class-II DAHP synthetase [141840] (2 protein domains) Pfam PF01474 |
![]() | Protein automated matches [191084] (3 species) not a true protein |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [337160] (3 PDB entries) |
![]() | Domain d5huca_: 5huc A: [337161] automated match to d3kgfb_ complexed with mn, mpd, pep, po4, trp |
PDB Entry: 5huc (more details), 2.45 Å
SCOPe Domain Sequences for d5huca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5huca_ c.1.10.8 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]} dlpplpegmqqqfedtisrdakqqptwdraqaenvrkilesvppivvapevlelkqklad vangkafllqggdcaetfesntephiranvktllqmavvltygastpvikmariagqyak prssdldgnglpnyrgdivngveatpearrhdparmirayanasaamnlvraltssgtad lyrlsewnrefvanspagaryealareidsglrfmeacgvsdeslraadiycsheallvd yersmlrlatdeegneelydlsahqlwigertrgmddfhvnfasmisnpigikigpgitp eeavayadkldpnfepgrltivarmghdkvrsvlpgviqaveasghkviwqsdpmhgntf tasngyktrhfdkvidevqgffevhralgthpggihieftgedvteclggaeditdvdlp gryesacdprlntqqslelaflvaemlrn
Timeline for d5huca_: