Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein multi-copper oxidase CueO, C-terminal domain [418909] (1 species) |
Species Escherichia coli [TaxId:562] [419323] (38 PDB entries) |
Domain d5gnoa3: 5gno A:336-516 [337143] Other proteins in same PDB: d5gnoa1, d5gnoa2 automated match to d4e9sa3 complexed with ca, cu, edo has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5gno (more details), 1.45 Å
SCOPe Domain Sequences for d5gnoa3:
Sequence, based on SEQRES records: (download)
>d5gnoa3 b.6.1.3 (A:336-516) multi-copper oxidase CueO, C-terminal domain {Escherichia coli [TaxId: 562]} slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft v
>d5gnoa3 b.6.1.3 (A:336-516) multi-copper oxidase CueO, C-terminal domain {Escherichia coli [TaxId: 562]} slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdfhhankingqafdmn kpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdtvkvegn vsevlvkfnhdapkehaymahchllehedtgmmlgftv
Timeline for d5gnoa3: