Lineage for d5gnoa3 (5gno A:336-516)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771385Protein multi-copper oxidase CueO, C-terminal domain [418909] (1 species)
  7. 2771386Species Escherichia coli [TaxId:562] [419323] (38 PDB entries)
  8. 2771404Domain d5gnoa3: 5gno A:336-516 [337143]
    Other proteins in same PDB: d5gnoa1, d5gnoa2
    automated match to d4e9sa3
    complexed with ca, cu, edo

    has additional insertions and/or extensions that are not grouped together

Details for d5gnoa3

PDB Entry: 5gno (more details), 1.45 Å

PDB Description: structure of multicopper oxidase cueo - signal peptide-free
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d5gnoa3:

Sequence, based on SEQRES records: (download)

>d5gnoa3 b.6.1.3 (A:336-516) multi-copper oxidase CueO, C-terminal domain {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft
v

Sequence, based on observed residues (ATOM records): (download)

>d5gnoa3 b.6.1.3 (A:336-516) multi-copper oxidase CueO, C-terminal domain {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdfhhankingqafdmn
kpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdtvkvegn
vsevlvkfnhdapkehaymahchllehedtgmmlgftv

SCOPe Domain Coordinates for d5gnoa3:

Click to download the PDB-style file with coordinates for d5gnoa3.
(The format of our PDB-style files is described here.)

Timeline for d5gnoa3: