SCOPe 2.08: Domain d1noya_: 1noy A:

Lineage for d1noya_ (1noy A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
   elaborated with additional structures and the N-terminal subdomain

7. Species Bacteriophage T4 [TaxId:10665] [53126] (2 PDB entries)
   additional N-terminal subdomain contains rudimental OB-fold

8. Domain d1noya_: 1noy A: [33713]
   exonuclease domain only
   protein/DNA complex; complexed with mn, zn
   has additional subdomain(s) that are not in the common domain

Details for d1noya_

PDB Entry: 1noy, 2.2 Å

PDB Description: dna polymerase (e.c.2.7.7.7)/dna complex

PDB Compounds: (A:) protein (DNA polymerase (e.c.2.7.7.7))

SCOPe Domain Sequences for d1noya_:

Sequence; same for both SEQRES and ATOM records:

>d1noya_ c.55.3.5 (A:) Exonuclease domain of family B DNA polymerases {Bacteriophage T4 [TaxId: 10665]}
defyisietvgnniveryidengkertreveylptmfrhckeeskykdiygkncapqkfp
smkdardwmkrmediglealgmndfklayisdtygseivydrkfvrvancdievtgdkfp
dpmkaeyeidaithydsiddrfyvfdllnsmygsvskwdaklaakldceggdevpqeild
rviympfdnerdmlmeyinlweqkrpaiftgwniegfdvpyimnrvkmilgersmkrfsp
igrvkskllqnmygskeiysidgvsildyldlykkfaftnlpsfslesvaqhetkkgklp
ydgpinklretnhqryisyniidvesvqaidkirgfidlvlsmsyyakmpfsgvmspikt
wdaiifnslkge

Timeline for d1noya_:

• d1noya_ first appeared (with stable ids) in SCOP 1.55
  
• d1noya_ appears in SCOPe 2.07