Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
Protein Exonuclease domain of family B DNA polymerases [53125] (8 species) elaborated with additional structures and the N-terminal subdomain |
Species Bacteriophage T4 [TaxId:10665] [53126] (2 PDB entries) additional N-terminal subdomain contains rudimental OB-fold |
Domain d1noya_: 1noy A: [33713] exonuclease domain only protein/DNA complex; complexed with mn, zn has additional subdomain(s) that are not in the common domain |
PDB Entry: 1noy (more details), 2.2 Å
SCOPe Domain Sequences for d1noya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1noya_ c.55.3.5 (A:) Exonuclease domain of family B DNA polymerases {Bacteriophage T4 [TaxId: 10665]} defyisietvgnniveryidengkertreveylptmfrhckeeskykdiygkncapqkfp smkdardwmkrmediglealgmndfklayisdtygseivydrkfvrvancdievtgdkfp dpmkaeyeidaithydsiddrfyvfdllnsmygsvskwdaklaakldceggdevpqeild rviympfdnerdmlmeyinlweqkrpaiftgwniegfdvpyimnrvkmilgersmkrfsp igrvkskllqnmygskeiysidgvsildyldlykkfaftnlpsfslesvaqhetkkgklp ydgpinklretnhqryisyniidvesvqaidkirgfidlvlsmsyyakmpfsgvmspikt wdaiifnslkge
Timeline for d1noya_: