Lineage for d5w7zb1 (5w7z B:1-122)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977454Species Rickettsia conorii [TaxId:272944] [337105] (1 PDB entry)
  8. 2977458Domain d5w7zb1: 5w7z B:1-122 [337120]
    Other proteins in same PDB: d5w7za4, d5w7zb4
    automated match to d1ok7a1
    complexed with edo, mrd

Details for d5w7zb1

PDB Entry: 5w7z (more details), 1.7 Å

PDB Description: crystal structure of dna polymerase iii subunit beta from rickettsia conorii
PDB Compounds: (B:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d5w7zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w7zb1 d.131.1.0 (B:1-122) automated matches {Rickettsia conorii [TaxId: 272944]}
mlklivetktlvqslgfassvvekrnvipeyaniklsakdgnlelsstnmdlylsqkiav
qvvsegectvstktlndivrklpdseltltdlgttgleikgknckfnlftlpvssfpamd
si

SCOPe Domain Coordinates for d5w7zb1:

Click to download the PDB-style file with coordinates for d5w7zb1.
(The format of our PDB-style files is described here.)

Timeline for d5w7zb1: