![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) ![]() |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) |
![]() | Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species) |
![]() | Species Bacteriophage T7 [TaxId:10760] [53124] (1 PDB entry) |
![]() | Domain d1t7pa1: 1t7p A:1-210 [33712] Other proteins in same PDB: d1t7pa2, d1t7pb_ |
PDB Entry: 1t7p (more details), 2.2 Å
SCOP Domain Sequences for d1t7pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t7pa1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7} mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll sdkhyfppeidftdvgyttfwses
Timeline for d1t7pa1: