Lineage for d1t7pa1 (1t7p A:1-210)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25363Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)
  6. 25419Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species)
  7. 25420Species Bacteriophage T7 [TaxId:10760] [53124] (1 PDB entry)
  8. 25421Domain d1t7pa1: 1t7p A:1-210 [33712]
    Other proteins in same PDB: d1t7pa2, d1t7pb_

Details for d1t7pa1

PDB Entry: 1t7p (more details), 2.2 Å

PDB Description: t7 dna polymerase complexed to dna primer/template,a nucleoside triphosphate, and its processivity factor thioredoxin

SCOP Domain Sequences for d1t7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7pa1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7}
mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
sdkhyfppeidftdvgyttfwses

SCOP Domain Coordinates for d1t7pa1:

Click to download the PDB-style file with coordinates for d1t7pa1.
(The format of our PDB-style files is described here.)

Timeline for d1t7pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t7pa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1t7pb_