![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
![]() | Protein automated matches [226907] (28 species) not a true protein |
![]() | Species Caulobacter crescentus [TaxId:190650] [337115] (2 PDB entries) |
![]() | Domain d5wcea1: 5wce A:1-118 [337116] automated match to d4tr8b1 |
PDB Entry: 5wce (more details), 1.9 Å
SCOPe Domain Sequences for d5wcea1:
Sequence, based on SEQRES records: (download)
>d5wcea1 d.131.1.0 (A:1-118) automated matches {Caulobacter crescentus [TaxId: 190650]} mkltieraallkalghvqsvverrntipilsnillsaegdrlsfsatdldmeiidegfaq idvpgqitapahtlyeivrklpdgadvslsfsgddprlviqagrsrfnlpvlpagdfp
>d5wcea1 d.131.1.0 (A:1-118) automated matches {Caulobacter crescentus [TaxId: 190650]} mkltieraallkalghvqsvverrntipilsnillsaegdrlsfsatdldmeiidegfaq idvpgqitapahtlyeivrklpdgadvslsfddprlviqagrsrfnlpvlpagdfp
Timeline for d5wcea1: