Lineage for d3bdpa1 (3bdp A:297-468)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 702237Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
    contains Pfam PF00929
  6. 702290Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 702291Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (42 PDB entries)
  8. 702335Domain d3bdpa1: 3bdp A:297-468 [33711]
    Other proteins in same PDB: d3bdpa2
    protein/DNA complex; complexed with 2dt, so4

Details for d3bdpa1

PDB Entry: 3bdp (more details), 1.9 Å

PDB Description: dna polymerase i/dna complex
PDB Compounds: (A:) protein (DNA polymerase I)

SCOP Domain Sequences for d3bdpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdpa1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
aamaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvraaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOP Domain Coordinates for d3bdpa1:

Click to download the PDB-style file with coordinates for d3bdpa1.
(The format of our PDB-style files is described here.)

Timeline for d3bdpa1: