SCOP 1.75: Domain d4bdpa1: 4bdp A:297-468

Lineage for d4bdpa1 (4bdp A:297-468)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (14 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (42 PDB entries)
   Uniprot Q45458 298-876 # 88% sequence identity
   Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462
   Uniprot Q45458 298-876 # 88% sequence identity ! Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462

8. Domain d4bdpa1: 4bdp A:297-468 [33710]
   Other proteins in same PDB: d4bdpa2
   protein/DNA complex; complexed with mg, so4

Details for d4bdpa1

PDB Entry: 4bdp, 1.8 Å

PDB Description: crystal structure of bacillus dna polymerase i fragment complexed to 11 base pairs of duplex dna after addition of two datp residues

PDB Compounds: (A:) protein (DNA polymerase I)

SCOP Domain Sequences for d4bdpa1:

Sequence; same for both SEQRES and ATOM records:

>d4bdpa1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
aamaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvraaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d4bdpa1:

• d4bdpa1 first appeared (with stable ids) in SCOP 1.55
  
• d4bdpa1 appears in SCOP 1.73
  
• d4bdpa1 appears in SCOPe 2.01
  
• d4bdpa1 appears in the current release, SCOPe 2.08