SCOP 1.67: Domain d4bdpa1: 4bdp A:297-468

Lineage for d4bdpa1 (4bdp A:297-468)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (9 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (24 PDB entries)

8. Domain d4bdpa1: 4bdp A:297-468 [33710]
   Other proteins in same PDB: d4bdpa2
   protein/DNA complex; complexed with mg, so4

Details for d4bdpa1

PDB Entry: 4bdp, 1.8 Å

PDB Description: crystal structure of bacillus dna polymerase i fragment complexed to 11 base pairs of duplex dna after addition of two datp residues

SCOP Domain Sequences for d4bdpa1:

Sequence; same for both SEQRES and ATOM records:

>d4bdpa1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
aamaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvraaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d4bdpa1:

• d4bdpa1 first appeared (with stable ids) in SCOP 1.55
  
• d4bdpa1 appears in SCOP 1.65
  
• d4bdpa1 appears in SCOP 1.69
  
• d4bdpa1 appears in the current release, SCOPe 2.08