Lineage for d5tude2 (5tud E:106-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753288Domain d5tude2: 5tud E:106-211 [337092]
    Other proteins in same PDB: d5tudb1, d5tudc1, d5tudc2, d5tude1, d5tudf1, d5tudf2
    automated match to d1dn0a2
    complexed with erm

Details for d5tude2

PDB Entry: 5tud (more details), 3 Å

PDB Description: structural insights into the extracellular recognition of the human serotonin 2b receptor by an antibody
PDB Compounds: (E:) Anti-5-HT2B Fab light chain

SCOPe Domain Sequences for d5tude2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tude2 b.1.1.2 (E:106-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglslpvtksfnrg

SCOPe Domain Coordinates for d5tude2:

Click to download the PDB-style file with coordinates for d5tude2.
(The format of our PDB-style files is described here.)

Timeline for d5tude2: