Lineage for d1taua3 (1tau A:290-422)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1859666Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1859846Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 1859911Species Thermus aquaticus [TaxId:271] [53121] (26 PDB entries)
  8. 1859937Domain d1taua3: 1tau A:290-422 [33707]
    Other proteins in same PDB: d1taua1, d1taua2, d1taua4
    protein/DNA complex; complexed with bgl, zn

Details for d1taua3

PDB Entry: 1tau (more details), 3 Å

PDB Description: taq polymerase (e.c.2.7.7.7)/dna/b-octylglucoside complex
PDB Compounds: (A:) protein (taq polymerase)

SCOPe Domain Sequences for d1taua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1taua3 c.55.3.5 (A:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
erlfanlwgrleg

SCOPe Domain Coordinates for d1taua3:

Click to download the PDB-style file with coordinates for d1taua3.
(The format of our PDB-style files is described here.)

Timeline for d1taua3: