SCOPe 2.02: Domain d1taua3: 1tau A:290-422

Lineage for d1taua3 (1tau A:290-422)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Thermus aquaticus [TaxId:271] [53121] (12 PDB entries)

8. Domain d1taua3: 1tau A:290-422 [33707]
   Other proteins in same PDB: d1taua1, d1taua2, d1taua4
   protein/DNA complex; complexed with bgl, zn

Details for d1taua3

PDB Entry: 1tau, 3 Å

PDB Description: taq polymerase (e.c.2.7.7.7)/dna/b-octylglucoside complex

PDB Compounds: (A:) protein (taq polymerase)

SCOPe Domain Sequences for d1taua3:

Sequence; same for both SEQRES and ATOM records:

>d1taua3 c.55.3.5 (A:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
erlfanlwgrleg

Timeline for d1taua3:

• d1taua3 first appeared (with stable ids) in SCOP 1.55
  
• d1taua3 appears in SCOPe 2.01
  
• d1taua3 appears in SCOPe 2.03
  
• d1taua3 appears in the current release, SCOPe 2.08